peplexicon
Choose your depth

The essentials in plain language

Amylin analog · 37 amino acids

Pramlintide

/PRAM-lin-tide/FDA-approved ingredient
Interactive anatomyExplore where this peptide acts.

The interactive model is optional on mobile so the evidence and safety context load first.

At a glance

What is it—and why does it matter?

Pramlintide (Symlin) is a synthetic version (analog) of the hormone amylin. In human studies, pramlintide (as an amylin analog) slows stomach emptying, reduces the after-meal rise in plasma glucagon, and increases satiety leading to lower calorie intake. In type 1 diabetes, HbA1c dropped by about the same amount with pramlintide and placebo at week 29. Do not use SYMLIN if there is serious allergy to it/components, hypoglycemia unawareness, or confirmed gastroparesis.

Evidence behind this overview

Each sentence above is copied from a published claim presentation. The links open its evidence record.

ClassAmylin analog
Structure37 amino acids
StatusFDA-approved ingredient
Products in this profile1
The simple version

Think of Pramlintide as the active molecule. The named products below are specific ways that molecule is formulated, approved, and used. [1]Regulatory labelSymlinPen prescribing informationDailyMed label including the boxed warning and patient-selection requirements.

Simple guide

Pramlintide, in plain English

The main points from the published research. Each one links to the source it comes from.

What it is

A lab-made peptide that copies amylin, a natural signal involved in appetite and after-meal blood sugar.

  • Pramlintide’s listed sequence is YTNSGVNTPPLIPGFNNSSHVLFNALRQTACTATNCK.

    Molecular data
    Source for this finding
    “Component 1: YTNSGVNTPPLIPGFNNSSHVLFNALRQTACTATNCK”
    PRAMLINTIDE
Status
FDA-approved ingredient
Approved use
Used only in carefully selected insulin-treated patients who can follow glucose monitoring and insulin-adjustment instructions.

What the research looks like

Most published findings come from studies in people.

Who or what was studied, across 45 findings:
  • 11 People 24%
  • 3 Animals or lab 7%
  • 31 Other or unclear 69%

Counts show where findings come from, not how strong they are. Animal and lab findings are counted together because study types have not been labelled for this profile yet.

What studies in people found

What animal and lab studies suggest

Not proven in people. Results in animals or cells often do not hold up in humans.

Safety

Boxed warning on the product label

Severe hypoglycemia can occur when pramlintide is used with insulin, especially in type 1 diabetes; risk-reduction instructions and patient selection are central to the label.

Serious risks listed on the product label:

  • Severe insulin-induced hypoglycemia
  • Medication errors involving insulin
  • Delayed absorption of concomitant oral medicines

Read the full label safety summary ↓

How it's used

These describe specific products as labelled or studied. They are not dosing instructions.

What we don't know

This profile does not list specific open questions yet.

A missing finding does not mean something is safe or effective.

Study types are labelled automatically and can be wrong; each finding links to its source.

This is general information, not medical advice.

Identity + structure

A molecule, not a product name.

Chemical identity and product identity are kept separate so evidence does not leak between formulations or indications.
Preferred namePramlintideIngredient
Pharmacologic classAmylin analogProfile record
Peptide structure37 amino acidsProfile record
Also indexed aspramlintide · pramlintide acetate · amylin analogSearch aliases

Mechanism + clinical pharmacology

What it does in the body.

Primary explanation

Slows gastric emptying, suppresses inappropriate post-meal glucagon secretion, and increases satiety, reducing postprandial glucose excursions. [1]Regulatory labelSymlinPen prescribing informationDailyMed label including the boxed warning and patient-selection requirements.

See all 56 findings and sourcesEvery finding, grouped by topic, with its exact source passages

Evidence ledger

What the evidence says.

45 profile findings. Contextual and unclassified research is listed separately below. Open each citation to inspect the source and its limitations.

These are evidence statements, not individualized medical instructions. Product, dose, population, and study context remain attached to each source.

Study findings

What studies observed in defined populations, comparators, and time periods.

9 statements
Source-backed statement

CHEMBL2103758 activated human CTR in transduced HeLa cells with EC50 = 0.3311 nM.

Sources[5]Published evidence snapshotChEMBL activities for CHEMBL2103758chembl-activities · T6
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

For AMY2 (human), pramlintide was tested by measuring ligand-induced cAMP production in COS and HEK293 cells.

Sources[9]Published evidence snapshotIUPHAR interactions for pramlintideiuphar-interactions · T6
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

3 cited passages across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

People on pramlintide lost weight while people on placebo gained weight.

Sources[11]Published evidence snapshotA double-blind, placebo-controlled trial assessing pramlintide treatment in the setting of intensive insulin therapy in type 1 diabetes.pubmed · T2
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide significantly reduces body weight in patients with type 1 and type 2 diabetes mellitus.

Sources[13]Published evidence snapshotPramlintide and the treatment of diabetes: a review of the data since its introduction.pubmed · T3
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

The study aimed to test pramlintide dose escalation (with insulin reductions) for safety, effectiveness, and tolerability in type 1 diabetes.

Sources[11]Published evidence snapshotA double-blind, placebo-controlled trial assessing pramlintide treatment in the setting of intensive insulin therapy in type 1 diabetes.pubmed · T2
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

At human CT receptor, pramlintide shows pEC50 8.3 (EC50 5.495x10 -9).

Sources[9]Published evidence snapshotIUPHAR interactions for pramlintideiuphar-interactions · T6
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

4 cited passages across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide significantly reduces hemoglobin A(1c) in patients with type 1 and type 2 diabetes mellitus.

Sources[13]Published evidence snapshotPramlintide and the treatment of diabetes: a review of the data since its introduction.pubmed · T3
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

CHEMBL2103758 activated human AMY1R (CTR/RAMP1) in transduced HeLa cells with EC50 = 0.02188 nM.

Sources[5]Published evidence snapshotChEMBL activities for CHEMBL2103758chembl-activities · T6
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

In type 1 diabetes, HbA1c dropped by about the same amount with pramlintide and placebo at week 29.

Sources[11]Published evidence snapshotA double-blind, placebo-controlled trial assessing pramlintide treatment in the setting of intensive insulin therapy in type 1 diabetes.pubmed · T2
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Mechanism

Source-backed statements about targets, pathways, and biological response.

2 statements
Source-backed statement

In human studies, pramlintide (as an amylin analog) slows stomach emptying, reduces the after-meal rise in plasma glucagon, and increases satiety leading to lower calorie intake.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

Pramlintide is likely digested in an infant’s gastrointestinal tract.

Sources[14]Published evidence snapshotpubmed-30000033pubmed · T3
Molecular / pharmacology evidence

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Pharmacokinetics

How the studied compound is absorbed, distributed, metabolized, and cleared.

6 statements
Source-backed statement

Pramlintide has a short half-life.

Sources[14]Published evidence snapshotpubmed-30000033pubmed · T3
Molecular / pharmacology evidence

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide is likely broken down in an infant’s gut.

Sources[14]Published evidence snapshotpubmed-30000033pubmed · T3
Molecular / pharmacology evidence

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide’s half-life in healthy people is about 48 minutes.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

Pramlintide was degraded at both the N- and C-termini, producing multiple stable metabolites that could be detection targets.

Sources[15]Published evidence snapshotIn vitro metabolic profiling of weight-loss-inducing amylin receptor agonists in the context of preventive doping research.pubmed · T3
Animal / laboratory evidence

1 cited source · Study independence not established

Animal or laboratory findings do not establish benefit or safety in people.

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide was broken down at both the N- and C-termini, producing multiple stable metabolites that could be used as detection targets.

Sources[15]Published evidence snapshotIn vitro metabolic profiling of weight-loss-inducing amylin receptor agonists in the context of preventive doping research.pubmed · T3
Animal / laboratory evidence

1 cited source · Study independence not established

Animal or laboratory findings do not establish benefit or safety in people.

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide is unlikely to pass into breastmilk in clinically important amounts because it has a high molecular weight.

Sources[14]Published evidence snapshotpubmed-30000033pubmed · T3
Molecular / pharmacology evidence

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Safety findings

Observed or labeled risks, adverse effects, and safety signals.

3 statements
Source-backed statement

Using SYMLIN with insulin raises the risk of severe hypoglycemia, especially in people with type 1 diabetes, and severe episodes are seen within 3 hours after a SYMLIN injection.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

SYMLIN by itself does not cause hypoglycemia.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

Using SYMLIN with insulin raises the risk of severe low blood sugar, especially in type 1 diabetes, and it is seen within 3 hours after an injection.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Contraindications

Circumstances in which a specific product label says it should not be used.

3 statements
Source-backed statement

Do not use SYMLIN if you have had a serious allergy to it or its components, have hypoglycemia unawareness, or have confirmed gastroparesis.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

Do not use SYMLIN if you have a serious allergy to it or its ingredients, hypoglycemia unawareness, or confirmed gastroparesis.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

Do not use SYMLIN if there is serious allergy to it/components, hypoglycemia unawareness, or confirmed gastroparesis.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Interactions

Source-backed product and drug interaction statements.

3 statements
Source-backed statement

If SYMLIN is mixed in one syringe with some insulins, pramlintide levels can change (up to a 40% lower Cmax and up to a 36% higher AUC0-∞).

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

Do not mix SYMLIN with insulin; give them as separate injections.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

Never mix SYMLIN and insulin; give them as separate injections because mixing can change how both work and may lead to poor glucose control or hypoglycemia.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Regulatory status

Product-, indication-, and jurisdiction-specific regulatory records.

1 statement
Source-backed statement

SYMLIN is approved as an add-on treatment for people with type 1 or type 2 diabetes who use mealtime insulin and still have not reached desired glucose control.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Administration

Product-specific route, timing, formulation, and use instructions—not universal dosing advice.

2 statements
Source-backed statement

Inject SYMLIN under the skin right before each major meal (at least 250 kcal or at least 30 grams of carbohydrate).

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

SYMLIN should be injected under the skin right before each major meal (≥250 kcal or ≥30 grams of carbohydrate).

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Dose records

Product- and indication-specific dose statements preserved separately to prevent unsafe generalization.

6 statements
Source-backed statement

In type 1 diabetes: reduce mealtime insulin by 50%, start SYMLIN 15 mcg under the skin before each major meal, and increase stepwise (30, 45, or 60 mcg) if there’s no clinically significant nausea for at least 3 days.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

In type 1 diabetes, start SYMLIN at 15 mcg under the skin right before each major meal, after cutting mealtime insulin by 50%.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

In type 2 diabetes on mealtime insulin: reduce mealtime insulin by 50%, start SYMLIN 60 mcg under the skin before each major meal, and raise to 120 mcg if there’s no clinically significant nausea for at least 3 days.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

When starting SYMLIN, cut mealtime insulin doses (including premixed insulin) by 50% to lower hypoglycemia risk.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

SYMLIN comes as a sterile injection in SymlinPen 60 (1.5 mL) and SymlinPen 120 (2.7 mL), each with 1000 mcg/mL pramlintide (as acetate).

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

In type 2 diabetes on mealtime insulin, start SYMLIN at 60 mcg under the skin right before each major meal, after cutting mealtime insulin by 50%.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Identity

Ingredient, molecule, and product identity statements.

10 statements
Source-backed statement

Pramlintide’s listed sequence is YTNSGVNTPPLIPGFNNSSHVLFNALRQTACTATNCK.

Sources[6]Published evidence snapshotPRAMLINTIDEchembl-molecule · T6
Molecular / pharmacology evidence

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide is a peptide (Ligand ID 7482) with INN pramlintide.

Sources[10]Published evidence snapshotpramlintideiuphar-ligand · T6
Molecular / pharmacology evidence

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide was based on the structure of non-aggregating rat amylin.

Sources[17]Published evidence snapshotLong-acting amylin-related peptides as therapies for obesity and type 2 diabetes.pubmed · T3
Animal / laboratory evidence

1 cited source · Study independence not established

Animal or laboratory findings do not establish benefit or safety in people.

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide (ChEMBL ID: CHEMBL2103758) is listed as a protein.

Sources[6]Published evidence snapshotPRAMLINTIDEchembl-molecule · T6
Molecular / pharmacology evidence

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide is a human amylin analogue with proline substitutions at positions 25, 28, and 29.

Sources[8]Published evidence snapshotIUPHAR ligand commentaryiuphar-comments · T6
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide is a human amylin analogue.

Sources[16]Published evidence snapshotpubmed-41708975pubmed · T3
Human research · design must be checked

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide (Symlin) is a synthetic version (analog) of the hormone amylin.

Sources[12]Published evidence snapshotReview of pramlintide as adjunctive therapy in treatment of type 1 and type 2 diabetes.pubmed · T3
Molecular / pharmacology evidence

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Pramlintide is a synthetic version of human amylin; it is an acetate salt of a 37-amino-acid peptide with proline substitutions at positions 25, 28, and 29 versus human amylin.

Sources[7]Published evidence snapshotThese highlights do not include all the information needed to use SYMLIN safely and effectively. See full prescribing information for SYMLIN.SYMLIN®(pramlintide acetate) injection for subcutaneous useInitial U.S. Approval: 2005dailymed · T1
Regulatory record

1 cited source · 1 regulatory record

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record.

Source-backed statement

Pramlintide’s molecular formula is C171H267N51O53S2.

Sources[6]Published evidence snapshotPRAMLINTIDEchembl-molecule · T6
Molecular / pharmacology evidence

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Source-backed statement

Amylin is a 37–amino acid peptide hormone released from pancreatic beta cells with insulin after meals.

Sources[12]Published evidence snapshotReview of pramlintide as adjunctive therapy in treatment of type 1 and type 2 diabetes.pubmed · T3
Molecular / pharmacology evidence

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Additional research & classification gaps

11 archived statements are kept separate from drug-effect findings. Media studies, economic models, methods, and records with unresolved scope are not used as medical-effect evidence.

Inspect contextual research (11)
Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Pramlintide lowers 2-hour after-meal blood glucose by between 3.4 and 5 mmol/L.

Research context only—not evidence of a treatment effect.

Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Pramlintide is unlikely to reach clinically important levels in an infant’s serum because it is likely digested in the infant’s gastrointestinal tract.

Research context only—not evidence of a treatment effect.

  • pubmed-30000033
    so it is unlikely to reach the clinically important levels in infant serum.
Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Pramlintide lowers A1C by 0.2% to 0.7%.

Research context only—not evidence of a treatment effect.

Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Pramlintide does not change fasting glucose levels.

Research context only—not evidence of a treatment effect.

Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Postprandial glucose excursions negatively affect glycemic control and markers of cardiovascular health.

Research context only—not evidence of a treatment effect.

Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Pramlintide is also known as AC-0137, AC0137, AC-137, AC137, Pramlintida, Pramlintide, and Tripro-amylin.

Research context only—not evidence of a treatment effect.

  • PRAMLINTIDE
    AC-0137; AC0137; AC-137; AC137; Pramlintida; Pramlintide; Tripro-amylin
Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

2 cited passages across 1 source record. 1 publication group(s) lack a resolved study identity.

Marketed pramlintide is the acetate salt.

Research context only—not evidence of a treatment effect.

Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Marketed pramlintide is the acetate salt (PubChem CID 16132446).

Research context only—not evidence of a treatment effect.

Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Amylin lowers blood sugar by reducing glucagon, slowing stomach emptying, and reducing food intake.

Research context only—not evidence of a treatment effect.

Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Amylin works with insulin to slow gastric emptying.

Research context only—not evidence of a treatment effect.

Research context · scope unclassified

1 cited source · Study independence not established

How to read this evidence

Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.

1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.

Amylin inhibits glucagon release.

Research context only—not evidence of a treatment effect.

Safety + tolerability

Risks, organized for scanning.

A structured orientation to the label—not a complete prescribing-information substitute or an individual risk estimate.
Boxed warning

Severe hypoglycemia can occur when pramlintide is used with insulin, especially in type 1 diabetes; risk-reduction instructions and patient selection are central to the label. [1]Regulatory labelSymlinPen prescribing informationDailyMed label including the boxed warning and patient-selection requirements.

Contraindications

  • Hypoglycemia unawareness
  • Confirmed gastroparesis
  • Serious hypersensitivity

Common effects

  • Nausea
  • Vomiting
  • Anorexia

Serious risks

  • Severe insulin-induced hypoglycemia
  • Medication errors involving insulin
  • Delayed absorption of concomitant oral medicines

Structured from current product labeling [1]Regulatory labelSymlinPen prescribing informationDailyMed label including the boxed warning and patient-selection requirements.

Products + regulatory context

Same ingredient. Different records.

Brand names, routes, presentations, indications, and instructions are product-specific. This table is an index—not a substitution guide.
ProductFormProfile scopeRecord
SymlinPenPremeal subcutaneous injectionAdjunct to mealtime insulin in selected adults whose desired glucose control has not been achieved.[1]Regulatory labelSymlinPen prescribing informationDailyMed label including the boxed warning and patient-selection requirements.

Do not infer dosing, interchangeability, or an approved use from the ingredient name alone. Open the current label for the exact product and presentation.

Administration, interactions + monitoring

The practical clinical context.

Administration boundary
Separate premeal subcutaneous injection; never mixed with insulin. Initiation requires a substantial label-directed mealtime insulin reduction and close monitoring. [1]Regulatory labelSymlinPen prescribing informationDailyMed label including the boxed warning and patient-selection requirements.

Research status + gaps

What still needs better answers.

A useful knowledge base names uncertainty as clearly as it names findings.
  • Some extracted findings are not shown because they did not pass Peplexicon's automated evidence checks.

How Peplexicon reads evidence

Authority
What kind of source is making the statement?
Independence
Do multiple citations represent separate studies—or the same evidence repeated?
Directness
Does the population, product, dose, outcome, and time horizon match the claim?
Consistency
Do credible sources support, qualify, or contradict one another?

References + discovery

Open the records yourself.

Authoritative records and published evidence are listed separately from live searches, which are discovery tools rather than pre-screened support.
  1. 1
    Regulatory labelSymlinPen prescribing information

    DailyMed label including the boxed warning and patient-selection requirements.

    Open ↗
  2. 2
    Literature indexEvery PubMed result for pramlintide

    Live National Library of Medicine literature search; results are not pre-screened or deduplicated.

    Open ↗
  3. 3
    Trial registryEvery registered study for pramlintide

    Live ClinicalTrials.gov search, including completed, active, and historical records.

    Open ↗