At a glance
What is it—and why does it matter?
Exenatide is a glucagon-like peptide-1 receptor agonist. Exenatide acts like gut incretin hormones and increases insulin release after meals. Common side effects (>1 in 10) included hypoglycaemia (with sulphonylurea ± metformin), nausea, vomiting, and diarrhoea.
Each sentence above is copied from a published claim presentation. The links open its evidence record.
Think of Exenatide as the active molecule. The named products below are specific ways that molecule is formulated, approved, and used. [1]Regulatory labelByetta prescribing informationCurrent DailyMed label for immediate-release exenatide.
Simple guide
Exenatide, in plain English
The main points from the published research. Each one links to the source it comes from.
What it is
A lab-made peptide medicine that copies a natural body signal involved in blood sugar and appetite.
The peptide studied was a GLP-1/apelin hybrid called exendin-4-linker-apelin (ELA), along with acylated forms including ELA-Lys12(γGluPal), ELA-Lys27(γGluPal), and ELA-Lys38(γGluPal).
Source for this finding
“To characterise the metabolic benefits of a GLP-1/apelin hybrid peptide, namely exendin-4-linker-apelin (ELA), and associated acylated forms, including ELA-Lys12(γGluPal), ELA-Lys27(γGluPal) and ELA-Lys38(γGluPal).”
Unimolecular GLP-1/Apelin Hybrid Peptides Cause Prominent Appetite Suppression, as Well as Enhancing Insulin Secretion, Beta-Cell Survival and Glycaemic Regulation.
- Status
- FDA-approved ingredient
- Approved use
- Immediate- and extended-release products are not interchangeable dosing formats.
What the research looks like
Most published findings come from studies in people.
- 66 People 33%
- 34 Animals or lab 17%
- 102 Other or unclear 50%
Counts show where findings come from, not how strong they are. Animal and lab findings are counted together because study types have not been labelled for this profile yet.
What studies in people found
68Ga-DOTANOC PET/CT was positive more often in aggressive insulinomas than in indolent cases (92.0% vs 67.7%; P = 0.047).
Source for this finding
“68Ga-DOTANOC PET/CT demonstrated a higher positivity rate in aggressive insulinomas compared with indolent cases (92.0% vs. 67.7%, P = 0.047).”
Glucagon-like peptide-1 receptor PET in indolent and aggressive insulinoma: Diagnostic performance, quantitative differences, and clinical implications.Overall glycaemic control with exenatide was similar to insulin glargine once daily or biphasic insulin aspart twice daily.
Source for this finding
“The overall intensity of glycaemic control with exenatide was similar to that achieved with once-daily insulin glargine or twice-daily biphasic insulin aspart.”
Exenatide: a review of its use in patients with type 2 diabetes mellitus (as an adjunct to metformin and/or a sulfonylurea).When used with metformin, exenatide had an overall hypoglycaemia rate similar to placebo.
Source for this finding
“The overall rate of hypoglycaemia was similar to rates observed with placebo (when administered with metformin)”
Exenatide: a review of its use in patients with type 2 diabetes mellitus (as an adjunct to metformin and/or a sulfonylurea).When used with metformin and a sulfonylurea, exenatide had an overall hypoglycaemia rate similar to insulin comparators.
Source for this finding
“and insulin comparators (when administered with metformin and a sulfonylurea).”
Exenatide: a review of its use in patients with type 2 diabetes mellitus (as an adjunct to metformin and/or a sulfonylurea).At 8 weeks, baseline-adjusted AUCGLP-1 was highest with glargine plus twice-daily exenatide.
Source for this finding
“baseline-adjusted AUCGLP-1 at 8 weeks was the highest in Glar/Exe (P = .037).”
Exenatide induces an enhanced endogenous glucagon-like peptide-1 secretory response in patients receiving basal insulin.
What animal and lab studies suggest
Not proven in people. Results in animals or cells often do not hold up in humans.
Starting PT320 late only partly improved neuropsychiatric deficits in MitoPark mice.
Source for this finding
“Late PT320 treatment partially ameliorated neuropsychiatric deficits”
pubmed-42585299Compared with doxorubicin alone, exenatide increased IL-10 by 115%, glutathione by 115%, and total antioxidant status by 87.8% in rats.
Source for this finding
“Relative to the doxorubicin group, exenatide lowered HMGB1 by 48.3%, hepatic99mTc-pyrophosphate uptake by 48.7%, malondialdehyde by 45.0%, total oxidant status by 37.3%, nitric oxide by 40.7%, NF-κB by 40.4%, TNF-α by 48.6%, and IL-6 by 41.1%, while increasing SIRT1 by 91.7%, IL-10 by 115%, glutathione by 115%, and total antioxidant status by 87.8%.”
Exenatide Attenuates Doxorubicin-Induced Acute Hepatic Injury Through Modulation of SIRT1-HMGB1 Signaling and Oxidative Stress.Starting PT320 (exenatide) early prevented anxiety- and depression-like behaviors in MitoPark mice.
Source for this finding
“ResultsEarly PT320 treatment effectively prevented the emergence of anxiety- and depression-like phenotypes in MP mice.”
pubmed-42585299
Safety
Serious risks listed on the product label:
- Acute pancreatitis
- Acute kidney injury
- Severe gastrointestinal disease
Do not use exenatide injection if you previously had a severe allergic reaction to exenatide or its ingredients.
Source for this finding
“A prior severe hypersensitivity reaction to exenatide or to any of the excipients in exenatide injection.”
These highlights do not include all the information needed to use EXENATIDE INJECTION safely and effectively. See full prescribing information for EXENATIDE INJECTION.EXENATIDE injection, for subcutaneous useInitial U.S. Approval: 2005BYETTA should not be used in patients who previously had severe hypersensitivity reactions to exenatide or product components.
Source for this finding
“BYETTA is contraindicated in patients with prior severe hypersensitivity reactions to exenatide or to any of the product components.”
These highlights do not include all the information needed to use BYETTA safely and effectively. See full prescribing information for BYETTA.BYETTA®(exenatide) InjectionInitial U.S. Approval: 2005Do not use BYETTA if there has been a prior severe hypersensitivity reaction to exenatide or any product component.
Source for this finding
“BYETTA is contraindicated in patients with prior severe hypersensitivity reactions to exenatide or to any of the product components.”
These highlights do not include all the information needed to use BYETTA safely and effectively. See full prescribing information for BYETTA.BYETTA®(exenatide) InjectionInitial U.S. Approval: 2005
How it's used
These describe specific products as labelled or studied. They are not dosing instructions.
Byetta is injected under the skin of the thigh, abdomen, or upper arm using the injection pen.
Source for this finding
“Byetta is given by injection under the skin of the thigh, the abdomen (tummy) or the upper arm, using the injection pen.”
Byetta | European Medicines Agency (EMA)If you use insulin too, inject BYETTA and insulin separately and never mix them; they can be in the same body region but not next to each other.
Source for this finding
“When using BYETTA with insulin, administer as separate injections and never mix. It is acceptable to inject BYETTA and insulin in the same body region, but the injections should not be adjacent to each other.”
These highlights do not include all the information needed to use BYETTA safely and effectively. See full prescribing information for BYETTA.BYETTA® (exenatide) injection, for subcutaneous useInitial U.S. Approval: 2005
What we don't know
This profile does not list specific open questions yet.
A missing finding does not mean something is safe or effective.
Identity + structure
A molecule, not a product name.
| Preferred name | Exenatide | Ingredient |
|---|---|---|
| Pharmacologic class | GLP-1 receptor agonist | Profile record |
| Peptide structure | 39 amino acids | Profile record |
| Also indexed as | exenatide · exendin-4 analog | Search aliases |
Mechanism + clinical pharmacology
What it does in the body.
Activates GLP-1 receptors, enhancing glucose-dependent insulin secretion, suppressing inappropriately elevated glucagon, slowing gastric emptying, and reducing food intake. [1]Regulatory labelByetta prescribing informationCurrent DailyMed label for immediate-release exenatide.
See all 231 findings and sourcesEvery finding, grouped by topic, with its exact source passages
Evidence ledger
What the evidence says.
These are evidence statements, not individualized medical instructions. Product, dose, population, and study context remain attached to each source.
Study findings
What studies observed in defined populations, comparators, and time periods.
At 8 weeks, baseline-adjusted AUCGLP-1 was highest with glargine plus twice-daily exenatide.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Starting PT320 late only partly improved neuropsychiatric deficits in MitoPark mice.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide lowered 2-hour OGTT glucose compared with placebo in adolescents with obesity.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Compared with doxorubicin alone, exenatide increased IL-10 by 115%, glutathione by 115%, and total antioxidant status by 87.8% in rats.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide showed no differences or trends versus placebo on clinical and cognitive measures.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Because studies differed too much, the review could not determine the independent effect of lifestyle interventions.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide reduced subcutaneous fat compared with placebo in adolescents with obesity.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide reduced weight compared with placebo in adolescents with obesity.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Starting PT320 (exenatide) early prevented anxiety- and depression-like behaviors in MitoPark mice.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In adults with obesity, GLP-1RA use was linked with higher odds of voice and resonance disorders than controls (OR 1.19; p = 0.002).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In this Parkinson’s mouse model, early PT320 prevented anxiety- and depression-like behaviors as the disease progressed.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
After 16 weeks of exenatide treatment, serum irisin decreased from 3.35 ± 0.64 ng/mL at baseline to 3.22 ± 0.53 ng/mL (P= 0.031).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Across all clinical-study patients, pulmonary vascular resistance decreased from 7.8 ± 8.0 WU to 5.9 ± 5.0 WU after exenatide.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide lowered % BMI 95th percentile compared with placebo in adolescents with obesity.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Compared with doxorubicin alone, exenatide increased SIRT1 by 91.7% in rats.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide did not significantly change liver fat content compared with placebo.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In this real-world study of adults with obesity, people starting exenatide lost about 4% of their weight after 12 months on average.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide was linked to modest improvements in some self-reported diet behaviors and self-reported physical activity.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In adolescents with obesity, exenatide for 6 months improved scores for choosing recommended foods and drinks versus placebo.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The psoriasis evidence on GLP-1 receptor agonists was limited and heterogeneous, with few randomized trials.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
At 8 weeks, fasting GLP-1 did not differ between the treatment groups.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
With late PT320 (exenatide) in MitoPark mice, partial neuropsychiatric improvement happened alongside more phasic dopamine release and recovered tyrosine hydroxylase in the nucleus accumbens.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In a subset of patients, right ventricular contractility and afterload improved during pressure-volume measurements after exenatide.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Across seven trials in 2845 adults with type 2 diabetes treated from 16 weeks to 3 years, exenatide (5 microg twice daily under the skin for 4 weeks, then 10 microg twice daily) dose-dependently reduced body weight.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In MCT rats, exenatide improved RV stroke-volume, RV ejection fraction, and RV-arterial coupling.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Objective physical activity measures and other lifestyle factors did not change with exenatide.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In an 18-month Phase II trial in early Alzheimer’s disease, exenatide was safe and well-tolerated.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
At 8 weeks, baseline-adjusted AUC for glucagon and GIP did not differ between groups (not significant).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
With exenatide, the measured changes did not fully return to control levels; the effect was partial attenuation.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In adults with obesity, GLP-1RA use was linked with higher 6-month odds of any laryngeal manifestations than controls (OR 1.19, 95% CI 1.16-1.21; p < 0.0001).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In three pivotal trials, twice-daily self-injected exenatide added on to therapy lowered A1C versus placebo in people with type 2 diabetes who were not controlled on maximum-dose metformin, sulfonylurea, or both.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Compared with doxorubicin alone, exenatide lowered HMGB1 by 48.3% and hepatic 99mTc-pyrophosphate uptake by 48.7% in rats.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Compared with doxorubicin alone, exenatide lowered NF-κB by 40.4%, TNF-α by 48.6%, and IL-6 by 41.1% in rats.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide reduced waist circumference compared with placebo in adolescents with obesity.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
After PT320 (exenatide) in MitoPark mice, RNA analysis showed higher Akt3, CREB, BDNF, and TrkB expression and changes in mitochondrial-homeostasis genes.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In antipsychotic-treated people with schizophrenia spectrum disorders, exenatide was associated with lower body weight than placebo (mean difference -2.97 kg; 95% CI -5.83 to -0.11; k = 3; moderate certainty).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Starting PT320 early prevented anxiety- and depression-like behaviors in MitoPark mice.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In vitro, exenatide lowered the fraction of dead cells.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In cell experiments, exenatide reduced the drop in viability caused by H2O2 and CCCP.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Across all clinical-study patients, cardiac index increased from 2.1 ± 0.6 L/min to 2.4 ± 0.9 L/min/m2 after exenatide.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In one study, HbA1c fell by 1.9 percentage points at 30 weeks with Bydureon versus 1.5 points with twice-daily exenatide.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
In phase III trials and post hoc completer analyses, adding subcutaneous exenatide twice daily was linked to progressive, significant weight loss from baseline for up to 2 years.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In adolescents with obesity, exenatide for 6 months reduced portion-size scores versus placebo.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Glucagon and GIP response profiles did not differ between the groups.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The review included pre-clinical and clinical studies of exenatide’s effects on Aβ and tau pathology.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In mice, inhibiting PrkcdCeA or Glp1rCeA neurons (but not SstCeA neurons) reduced the full hypophagic effect of Exendin-4.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In adolescents with obesity, exenatide for 6 months increased self-reported physical activity versus placebo.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In adults with obesity, GLP-1RA use was linked with higher odds of cough than controls (OR 1.46; p < 0.0001).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Starting PT320 (exenatide) late partly improved neuropsychiatric deficits in MitoPark mice.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Across seven trials in 2845 adults with type 2 diabetes treated from 16 weeks to 3 years, exenatide (5 microg twice daily under the skin for 4 weeks, then 10 microg twice daily) dose-dependently lowered HbA1c.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Compared with doxorubicin alone, exenatide lowered malondialdehyde by 45.0%, total oxidant status by 37.3%, and nitric oxide by 40.7% in rats.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Over six months, exenatide lowered BMI-SDS compared with placebo in adolescents with obesity.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Lifestyle programs varied widely, from general diet advice to structured multidisciplinary programs with nutrition, activity, and behavioral/family support.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In Parkinson’s disease trials, exenatide 20 µg/day improved ON-state motor scores (MDS-UPDRS Part III) by a mean difference of −9.80 (95% CI −14.47 to −5.13).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In vitro, exenatide helped maintain mitochondrial membrane potential.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
On the 8-week OGTT, baseline-adjusted GLP-1 was highest with glargine plus twice-daily exenatide at 30, 60, and 90 minutes.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In one study, HbA1c fell by 1.6 points at 24 weeks with Bydureon versus 0.9 points with twice-daily exenatide.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
At 8 weeks, people on glargine plus twice-daily exenatide had higher GLP-1 levels at 30 and 60 minutes after the glucose challenge than the other treatments.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Across all clinical-study patients, mean pulmonary artery pressure decreased from 45 ± 15 mmHg to 40 ± 18 mmHg after exenatide.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The conclusion says GLP-1RA/GIP use in adults is linked to higher rates of laryngeal symptoms, especially cough and voice/resonance disorders.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide did not differ from placebo for meal frequency, snacking, sleep, screen time, or objective physical fitness/activity measures in adolescents with obesity.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Comparative evidence
How the studied intervention compared with another intervention, comparator, or threshold.
68Ga-DOTANOC PET/CT was positive more often in aggressive insulinomas than in indolent cases (92.0% vs 67.7%; P = 0.047).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Overall glycaemic control with exenatide was similar to insulin glargine once daily or biphasic insulin aspart twice daily.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
When used with metformin, exenatide had an overall hypoglycaemia rate similar to placebo.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
When used with metformin and a sulfonylurea, exenatide had an overall hypoglycaemia rate similar to insulin comparators.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Mechanism
Source-backed statements about targets, pathways, and biological response.
The findings suggest exenatide may shift mitochondria toward more fusion than fission.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide bound to human GLP-1 receptors in CHOK1 cells with IC50 0.66 nM (radioligand displacement).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The study used sensitivity analyses with positive and negative controls to check how robust the exenatide-including FAERS signals were.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exendin-4’s anxiolytic effect involved activating GLP-1 receptors in the basolateral amygdala.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Results fit with SIRT1-HMGB1/NF-κB-related signaling being involved, but this study does not prove it causes the effects.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
New GLP-1RA delivery approaches include nanocarriers, microcarriers, hydrogels, microneedles, and long-acting or co-/nano-formulated agents.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Hormone secretion was measured during a 2-hour OGTT at baseline and after stopping treatment at 8 weeks, with blood levels checked every 30 minutes.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
GLP-1 stimulates insulin release when glucose is present.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The study used logistic regression to calculate crude and adjusted reporting odds ratios for exenatide while controlling for confounders.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
GLP-1R/PKA/CREB1 signaling was markedly downregulated in atRAL-challenged 661W cells and in neural retina of light-exposed Abca4-/-Rdh8-/- mice.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
With PT320, gene expression increases (Akt3, CREB, BDNF, TrkB) and mitochondrial-homeostasis genes were modulated.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In vivo, peripheral Exendin-4 quickly and persistently activated central amygdala neurons, and Exendin-9 pretreatment blocked this activation.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The study design tested prevention (attenuation) rather than reversal of existing injury.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide activated human GLP-1 receptors in CHO cells with EC50 0.004 nM (cAMP luciferase assay).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In these experiments, exenatide was linked to higher OPA1 expression.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The analysis combined injection-site and skin-related events into a single "Skin and Injection-Site Reactions" category (used for exenatide and other GLP-1RAs).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide acts like incretin hormones and increases insulin release from the pancreas in response to food.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
The primary outcome was time to first of: death, stroke, dialysis-requiring renal failure, or new/worsening heart failure.
1 cited source · 1 linked study ID
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Exenatide acts like gut incretin hormones and increases insulin release after meals.
2 cited sources · 2 regulatory records
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
3 cited passages across 2 source records.
The results are consistent with SIRT1-HMGB1/NF-κB-related signaling, but causality was not established.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The peptides were tested in vitro for concentration- and receptor-dependent effects on insulin secretion and beta-cell turnover.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide was linked to more Drp1 phosphorylation at Ser637.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Pharmacokinetics
How the studied compound is absorbed, distributed, metabolized, and cleared.
Exenatide’s mean terminal half-life in humans is 2.4 hours.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
GLP-1 has a short half-life in the body.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
All ELA peptides were enzymatically stable in murine plasma.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In IGT patients, exenatide 10 ug subcutaneously twice daily had a terminal half-life of 2.4 hr.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In dialysis patients with end-stage renal disease, mean exenatide exposure increased by 3.37-fold versus normal renal function.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Exenatide is a large peptide with a molecular weight of 4187 daltons.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
GLP-1 analogs have limited oral bioavailability due to enzymatic degradation and poor intestinal permeability.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
After a subcutaneous dose in patients with type 2 diabetes, exenatide reaches median peak blood levels in 2.1 hours.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Safety findings
Observed or labeled risks, adverse effects, and safety signals.
Pancreatitis, including serious and sometimes fatal types, has been seen in people treated with BYETTA and other GLP-1 receptor agonists.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
In adults, the most common side effects are nausea and diarrhoea.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Common side effects (>1 in 10) included hypoglycaemia (with sulphonylurea ± metformin), nausea, vomiting, and diarrhoea.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
People can develop antibodies to exenatide on BYETTA; in 3%, 4%, and 1% of patients in the 30-week, 24-week, and 16-week studies, antibodies were linked to a reduced glycemic response.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Using exenatide with a sulfonylurea (or other insulin secretagogue) or insulin can increase the risk of hypoglycemia, including severe hypoglycemia.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
In adults, the most common side effects of Bydureon are nausea and diarrhoea.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
2 cited passages across 1 source record.
Never share exenatide pens between patients, even with a new needle, because it can spread blood-borne pathogens.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Acute pancreatitis (including fatal and non-fatal hemorrhagic or necrotizing pancreatitis) has been observed with GLP-1 receptor agonists, including exenatide.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Acute pancreatitis, including fatal and non-fatal hemorrhagic or necrotizing pancreatitis, has been observed with GLP-1 receptor agonists including BYETTA.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Never share a BYETTA pen, even with a new needle, because it can spread blood-borne infections.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Contraindications
Circumstances in which a specific product label says it should not be used.
Do not use exenatide injection if you previously had a severe allergic reaction to exenatide or its ingredients.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
BYETTA should not be used in patients who previously had severe hypersensitivity reactions to exenatide or product components.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Do not use BYETTA if there has been a prior severe hypersensitivity reaction to exenatide or any product component.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
2 cited passages across 1 source record.
Do not use BYETTA if you previously had drug-induced immune thrombocytopenia from an exenatide medicine.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Do not use Byetta if you are allergic to exenatide or any ingredient in the product.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Do not use exenatide injection if you had drug-induced immune-mediated thrombocytopenia from exenatide products.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
BYETTA is not recommended for people with severe kidney impairment (creatinine clearance <30 mL/min) or end-stage kidney disease.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Do not use exenatide injection if you have had a severe allergic reaction to exenatide or its ingredients.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Do not use BYETTA if you have had a severe allergic reaction to exenatide or any ingredient in BYETTA.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Do not use BYETTA if you have had a severe allergic reaction to exenatide or any BYETTA ingredient.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Do not use BYETTA if you have had a severe allergic reaction to exenatide or BYETTA’s ingredients.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Interactions
Source-backed product and drug interaction statements.
BYETTA can slow how fast some oral medicines are absorbed because it slows gastric emptying.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Do not use BYETTA together with other medicines that contain exenatide.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
If Bydureon is added to insulin, the insulin dose may need adjustment.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Using BYETTA with a sulfonylurea increases the risk of hypoglycemia.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Do not use exenatide injection together with other products that contain exenatide.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Using BYETTA with a sulfonylurea or insulin can raise the risk of low blood sugar, including severe low blood sugar.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
BYETTA can slow gastric emptying and reduce how much and how fast some oral drugs are absorbed.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
If Bydureon is added to a sulphonylurea, the sulphonylurea dose may need lowering because of low blood sugar risk.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Do not use BYETTA together with other medicines that contain exenatide.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Postmarketing reports describe increased INR, sometimes with bleeding, when warfarin is used with BYETTA.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Regulatory status
Product-, indication-, and jurisdiction-specific regulatory records.
Exenatide injection is used with diet and exercise to improve blood sugar control in adults with type 2 diabetes.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
3 cited passages across 1 source record.
Bydureon received EU-wide marketing authorisation on 17 June 2011.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Administration
Product-specific route, timing, formulation, and use instructions—not universal dosing advice.
Byetta is injected under the skin of the thigh, abdomen, or upper arm using the injection pen.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
If you use insulin too, inject BYETTA and insulin separately and never mix them; they can be in the same body region but not next to each other.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Bydureon is injected under the skin once a week (same day each week) in the abdomen, thigh, or back of the upper arm.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Start BYETTA at 5 mcg twice daily within 60 minutes before morning and evening meals; if needed, increase to 10 mcg twice daily after 1 month. Inject under the skin in the thigh, abdomen, or upper arm, and do not give after a meal.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
BYETTA is a clear, colorless exenatide solution in single-patient prefilled pens: 5 mcg per dose (300 mcg/1.2 mL; 250 mcg/mL; 60 doses) and 10 mcg per dose (600 mcg/2.4 mL; 250 mcg/mL; 60 doses).
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
If using insulin too, inject exenatide separately and never mix them; you can use the same body region but not right next to each other.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Byetta is injected under the skin in the thigh, tummy, or upper arm using a pen.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Exenatide Injection, USP is a clear, colorless sterile solution for under-the-skin injection with 250 mcg/mL exenatide.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
If you use insulin, inject BYETTA separately and never mix them; you can use the same body region but not side-by-side.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Inject each BYETTA dose under the skin in the thigh, abdomen, or upper arm.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Dose records
Product- and indication-specific dose statements preserved separately to prevent unsafe generalization.
Start BYETTA at 5 mcg twice daily within 60 minutes before morning and evening meals; it can be increased to 10 mcg twice daily after 1 month based on response.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
If needed, increase BYETTA to 10 mcg twice daily after 1 month to lower the risk of stomach-related side effects.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
If needed, BYETTA can be increased to 10 mcg twice daily after 1 month.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
In a clinical study, three people with type 2 diabetes each took a single 100 mcg subcutaneous overdose (10-times the maximum recommended dose).
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Start exenatide injection at 5 mcg under the skin twice daily within 60 minutes before morning and evening meals (about 6 hours apart).
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Start BYETTA at 5 mcg twice daily within 60 minutes before morning and evening meals; it can be increased to 10 mcg twice daily after 1 month based on response.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
BYETTA is a 250 mcg/mL sterile solution in prefilled pens that deliver 5 mcg or 10 mcg per dose (60 doses each).
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Start exenatide injection at 5 mcg under the skin twice daily within 60 minutes before morning and evening meals (about 6 hours apart).
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
2 cited passages across 1 source record.
BYETTA is a sterile 250 mcg/mL exenatide solution in prefilled pens: 5 mcg per dose (60 doses, 1.2 mL) and 10 mcg per dose (60 doses, 2.4 mL).
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Byetta usually starts at 5 micrograms twice a day for at least 1 month, then may be increased to 10 micrograms twice a day.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
More than 10 micrograms twice a day is not recommended for Byetta.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Start BYETTA at 5 mcg under the skin twice daily within 60 minutes before morning and evening meals; do not take it after a meal.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
3 cited passages across 1 source record.
Byetta starts at 5 micrograms twice daily for at least a month, can be increased to 10 micrograms twice daily, and higher than 10 micrograms twice daily is not recommended.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
If needed, exenatide injection can be increased to 10 mcg twice daily after 1 month.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Studied populations
Who was represented in a study, label, or registry record.
Bydureon is used with other diabetes medicines (including long-acting insulin) for adults and children aged 10 years and above with type 2 diabetes when other medicines don’t control blood sugar well enough.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Byetta is used for type-2 diabetes.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Byetta is used to treat type-2 diabetes.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Bydureon (exenatide) is used with other diabetes medicines, including long-acting insulin, for adults and children aged 10 years and above with type 2 diabetes when other medicines do not control blood sugar well enough.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
BYETTA is not recommended in end-stage renal disease or severe renal impairment (creatinine clearance <30 mL/min) and should be used cautiously in people with renal transplantation.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
BYETTA is not recommended in end-stage renal disease or severe renal impairment (creatinine clearance < 30 mL/min).
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Identity
Ingredient, molecule, and product identity statements.
The peptide studied was a GLP-1/apelin hybrid called exendin-4-linker-apelin (ELA), along with acylated forms including ELA-Lys12(γGluPal), ELA-Lys27(γGluPal), and ELA-Lys38(γGluPal).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide was one of the GLP-1 receptor agonists evaluated for pregnancy exposure in the included studies.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
This analysis included exenatide extended release as one of the GLP-1 receptor agonist treatments studied.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Having an exenatide prescription counted someone as a GLP-1 user in this study.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
This review covers innovative delivery technologies for exenatide as a main GLP-1 receptor agonist.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
This review includes exenatide among the obesity medications it plans to discuss.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide was one of the GLP-1 receptor agonist drugs evaluated.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is a GLP-1 receptor agonist.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The study included adults with obesity who started exenatide.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide (Byetta) is a novel, synthetic incretin mimetic peptide that regulates glucose.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Byetta is an injectable solution containing exenatide, supplied in prefilled pens that deliver 5 or 10 micrograms per dose.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Exenatide is a GLP-1 receptor agonist (GLP-1 RA).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide’s listed molecular formula is C184H282N50O60S.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Sita-Ex-Cs-SeNPs are chitosan-selenium nanoparticles loaded with sitagliptin and conjugated with exenatide.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is a GLP-1 (glucagon-like peptide-1) agonist.
1 cited source · 1 linked study ID
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Byetta is an injectable exenatide medicine in prefilled pens that give 5 or 10 micrograms per dose.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Exenatide is found in the venom of the Gila monster (Heloderma suspectum).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
This review included exenatide in 5 studies.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is a GLP-1 agonist.
1 cited source · 1 linked study ID
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Exenatide is a GLP-1 receptor agonist.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide was one of the six GLP-1 receptor agonists included in the FAERS analysis.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is a synthetic form of the peptide used clinically.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
BYETTA is a sterile subcutaneous injection solution (250 mcg/mL exenatide) supplied in prefilled pens: 5 mcg per dose (60 doses, 1.2 mL) or 10 mcg per dose (60 doses, 2.4 mL).
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Exenatide was one of the GLP-1 receptor agonists included in primary research assessed for suicidality.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is a 39-amino acid peptide amide with molecular weight of 4186.6 Daltons.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
PT320 is a sustained-release GLP-1 receptor agonist (exenatide).
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
2 cited passages across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide was one of the GLP-1 receptor agonists counted as GLP-1 RA use in this study.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
PT320 is a sustained-release GLP-1 receptor agonist (exenatide).
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide was one of the GLP-1 receptor agonists assessed in this EudraVigilance safety-report analysis.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is a synthetic form of a protein found in Gila monster saliva.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide’s listed molecular weight is 4186.64.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Ligand ID 1135 is named exendin-4.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is described as synthetic exendin-4 (EX-4).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
This scoping review included 4 human studies that assessed exenatide monotherapy and energy expenditure.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is a glucagon-like peptide-1 receptor agonist.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide (BYETTA) is a synthetic peptide GLP-1 receptor agonist originally identified in the lizard Heloderma suspectum.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Exenatide is one of the GLP-1 receptor agonists included in this study.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide was one of the GLP-1 receptor agonists prescribed in this adult obesity-and-IBD cohort study.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide was one of the GLP-1 receptor agonists tested in diet-induced obese mice.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is a 39-amino acid peptide amide with a molecular weight of 4186.6 Daltons.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
One listed exenatide sequence is SPPPAGSSPGGNKLWEIFLRVAEEEMQKSLDSTFTGEGH.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Bydureon contains exenatide.
1 cited source · 1 regulatory record
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Exenatide (CHEMBL414357) is listed as a protein.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is a GLP-1 agonist.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Additional research & classification gaps
29 archived statements are kept separate from drug-effect findings. Media studies, economic models, methods, and records with unresolved scope are not used as medical-effect evidence.
Inspect contextual research (29)
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
68Ga-DOTANOC PET/CT was more often positive in aggressive than indolent insulinomas (92.0% vs. 67.7%; P = 0.047).
Research context only—not evidence of a treatment effect.
- Glucagon-like peptide-1 receptor PET in indolent and aggressive insulinoma: Diagnostic performance, quantitative differences, and clinical implications.
Conversely,68Ga-DOTANOC PET/CT demonstrated a higher positivity rate in aggressive insulinomas compared with indolent cases (92.0% vs. 67.7%, P = 0.047).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide was compared against control groups that included placebo and non-placebo controls.
Research context only—not evidence of a treatment effect.
- Glucagon-like peptide-1 receptor agonists for weight management in mental illness: a network meta-analysis.
alongside a control group (placebo, k = 8; non-placebo, k = 1).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
68Ga-exendin-4 PET/CT detected aggressive insulinomas less often than indolent tumors (76.0% vs. 98.4%; P = 0.002).
Research context only—not evidence of a treatment effect.
- Glucagon-like peptide-1 receptor PET in indolent and aggressive insulinoma: Diagnostic performance, quantitative differences, and clinical implications.
Detection rate for aggressive insulinomas was significantly lower than that for indolent tumors (76.0% vs. 98.4%, P = 0.002).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Because the study ended early, it was underpowered and firm conclusions cannot be drawn.
Research context only—not evidence of a treatment effect.
- A Pilot Study of Exenatide Actions in Alzheimer's Disease.
The study was underpowered due to early termination and therefore we cannot draw any firm conclusions.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Under intermittent high-fat diet access, inhibiting Glp1rCeA neurons significantly reversed Exendin-4’s reduction of high-fat diet consumption.
Research context only—not evidence of a treatment effect.
- The central amygdala gates exogenous glucagon-like peptide 1 signals.
We used intermittent high-fat diet (HFD) access and found that inhibition of Glp1rCeAneurons significantly rescued the reduction of HFD consumption by Ex-4.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
For indolent insulinomas, 68Ga-exendin-4 PET/CT had 98.4% sensitivity, 71.4% specificity, and 95.8% accuracy.
Research context only—not evidence of a treatment effect.
- Glucagon-like peptide-1 receptor PET in indolent and aggressive insulinoma: Diagnostic performance, quantitative differences, and clinical implications.
For indolent insulinomas,68Ga-exendin-4 PET/CT demonstrated a sensitivity of 98.4%, specificity of 71.4%, and accuracy of 95.8%.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In indolent insulinomas, 68Ga-exendin-4 PET/CT had sensitivity 98.4%, specificity 71.4%, and accuracy 95.8%.
Research context only—not evidence of a treatment effect.
- Glucagon-like peptide-1 receptor PET in indolent and aggressive insulinoma: Diagnostic performance, quantitative differences, and clinical implications.
For indolent insulinomas,68Ga-exendin-4 PET/CT demonstrated a sensitivity of 98.4%, specificity of 71.4%, and accuracy of 95.8%.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Six PAH-prognosis-related metabolites in myocardial glycolytic and lipid oxidation pathways were altered after exenatide.
Research context only—not evidence of a treatment effect.
- Hemodynamic and metabolomic responses to infusion of GLP-1 agonist exenatide in pulmonary arterial hypertension.
Six metabolites with prognostic relevance in PAH within myocardial glycolytic and lipid oxidation pathways were also altered after exenatide.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide showed no differences or trends versus placebo in MRI cortical thickness and volume.
Research context only—not evidence of a treatment effect.
- A Pilot Study of Exenatide Actions in Alzheimer's Disease.
Exenatide treatment produced no differences or trends compared to placebo for clinical and cognitive measures, MRI cortical thickness and volume, or biomarkers in CSF, plasma, and plasma neuronal extracellular vesicles (EV) except for a reduction of Aβ42 in EVs.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Inhibiting Glp1rCeA modestly reduced Exendin-4–induced hypophagia on standard chow.
Research context only—not evidence of a treatment effect.
- The central amygdala gates exogenous glucagon-like peptide 1 signals.
Having observed that inhibition of Glp1rCeAmodestly attenuated Ex-4 induced hypophagia of standard chow, we then tested whether these neurons might mediate Ex-4 suppression of energy-dense, palatable diet.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Inhibiting all central amygdala neurons significantly reduced Exendin-4’s hypophagic effect.
Research context only—not evidence of a treatment effect.
- The central amygdala gates exogenous glucagon-like peptide 1 signals.
Chemogenetic inhibition of all CeA neurons significantly suppressed the hypophagic actions of Ex-4.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
With GLP-1 receptor agonists like exenatide, about 20-30% of the total weight loss is lean mass.
Research context only—not evidence of a treatment effect.
- Incretin-Based Therapies in Sports: Pharmacological Mechanisms, Performance-Enhancing Potential, and Anti-Doping Implications-A Narrative Review.
but also reduce lean mass by 20-30% of total weight loss.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Higher baseline NT-proBNP predicted higher risk of MACE, all-cause death, CV death, and heart-failure hospitalization.
Research context only—not evidence of a treatment effect.
- pubmed-42102896
Baseline NT-proBNP was strongly prognostic (adjusted HR per 1 integer unit 1.63 for MACE, 1.85 for ACM, 2.17 for CV death, and 2.17 for hHF; all P < .001).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
This review aimed to assess exenatide’s effects on Alzheimer’s pathology, focusing on hyperphosphorylated tau and Aβ.
Research context only—not evidence of a treatment effect.
- The effects of GLP-1 receptor agonists on Alzheimer's pathophysiology: A systematic review.
This systematic review aims to evaluate the effectiveness of liraglutide, semaglutide, exenatide and dulaglutide on AD pathology with a focus on the key biomarkers: hyperphosphorylated tau and Aβ.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
In an exploratory metabolomics analysis, 47 metabolite levels changed after exenatide infusion, mostly in free fatty acid pathways.
Research context only—not evidence of a treatment effect.
- Hemodynamic and metabolomic responses to infusion of GLP-1 agonist exenatide in pulmonary arterial hypertension.
In an exploratory metabolomics analysis, 47 metabolite levels changed after exenatide infusion, predominantly in free fatty acid pathways.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
GLP-1 analogs are highly effective for managing type 2 diabetes and obesity.
Research context only—not evidence of a treatment effect.
- A two-tier protection strategy for oral delivery of GLP-1 peptides: lipid-based formulation combined with enteric capsules.
Glucagon-like peptide-1 (GLP-1) analogs, in particular, are highly effective for the management of type 2 diabetes mellitus and obesity, yet their oral bioavailability remains limited by enzymatic degradation and poor intestinal permeability.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
New delivery technologies may help overcome limits of traditional GLP-1RA delivery and improve therapeutic effectiveness.
Research context only—not evidence of a treatment effect.
- Advances in GLP-1 receptor agonists delivery systems for obesity and diabetes.
Novel delivery technologies offer promising strategies to overcome these challenges and enhance therapeutic effectiveness.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Byetta and Bydureon are listed as synonyms for exenatide.
Research context only—not evidence of a treatment effect.
- EXENATIDE
AC-002993; AC002993; AC 2993; AC-2993; AC2993; AC-2993A; AC2993A; AC-2993LAR; Bydureon; Bydureon bcise; Bydureon pen; Byetta; DA-3091; Exenatida; Exenatide; Exenatide synthetic; Exendin 4; EXENDIN-4; ITCA-650; LY-2148568; LY2148568
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide is synthetic exendin-4.
Research context only—not evidence of a treatment effect.
- Pharmacology of exenatide (synthetic exendin-4): a potential therapeutic for improved glycemic control of type 2 diabetes.
Exenatide (synthetic exendin-4)
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exendin 4 (EXENDIN-4) is listed as a synonym for exenatide.
Research context only—not evidence of a treatment effect.
- EXENATIDE
AC-002993; AC002993; AC 2993; AC-2993; AC2993; AC-2993A; AC2993A; AC-2993LAR; Bydureon; Bydureon bcise; Bydureon pen; Byetta; DA-3091; Exenatida; Exenatide; Exenatide synthetic; Exendin 4; EXENDIN-4; ITCA-650; LY-2148568; LY2148568
2 cited sources · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
2 cited passages across 2 source records. 2 publication group(s) lack a resolved study identity.
Exenatide suppresses glucagon secretion when it is inappropriately high.
Research context only—not evidence of a treatment effect.
- Exenatide: a review from pharmacology to clinical practice.
suppressing inappropriately high glucagon secretion
- Exenatide: from the Gila monster to the pharmacy.
Exenatide offers a wide range of beneficial glucoregulatory effects, including enhancement of glucose-dependent insulin secretion, restoration of first-phase insulin response, suppression of inappropriately elevated glucagon secretion
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Results fit with SIRT1–HMGB1/NF-κB signaling involvement, but they don’t prove it causes the effect.
Research context only—not evidence of a treatment effect.
- Exenatide Attenuates Doxorubicin-Induced Acute Hepatic Injury Through Modulation of SIRT1-HMGB1 Signaling and Oxidative Stress.
The findings are consistent with involvement of SIRT1-HMGB1/NF-κB-related signaling, but they do not establish causality.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide HIP made with sodium docusate (1:4 molar ratio) changed lipophilicity (log P = -2.9 ± 0.3 vs. 0.9 ± 0.2 for exenatide).
Research context only—not evidence of a treatment effect.
- A two-tier protection strategy for oral delivery of GLP-1 peptides: lipid-based formulation combined with enteric capsules.
EXE-HIP was prepared with sodium docusate (1:4 molar ratio), which increased lipophilicity (log P = -2.9 ± 0.3 vs. 0.9 ± 0.2 for EXE)
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide slows stomach emptying.
Research context only—not evidence of a treatment effect.
- Exenatide: a review from pharmacology to clinical practice.
and delaying gastric emptying.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide slows gastric emptying.
Research context only—not evidence of a treatment effect.
- Exenatide: from the Gila monster to the pharmacy.
Exenatide offers a wide range of beneficial glucoregulatory effects, including enhancement of glucose-dependent insulin secretion, restoration of first-phase insulin response, suppression of inappropriately elevated glucagon secretion, slowing of gastric emptying
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide reduces the after-meal rise in blood glucose by increasing insulin release when glucose is high.
Research context only—not evidence of a treatment effect.
- Exenatide: a review from pharmacology to clinical practice.
It blunts the postprandial rise of plasma glucose by increasing glucose-dependent insulin secretion,
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide restores first-phase insulin response.
Research context only—not evidence of a treatment effect.
- Exenatide: from the Gila monster to the pharmacy.
Exenatide offers a wide range of beneficial glucoregulatory effects, including enhancement of glucose-dependent insulin secretion, restoration of first-phase insulin response
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Exenatide reduces food intake.
Research context only—not evidence of a treatment effect.
- Exenatide: from the Gila monster to the pharmacy.
Exenatide offers a wide range of beneficial glucoregulatory effects, including enhancement of glucose-dependent insulin secretion, restoration of first-phase insulin response, suppression of inappropriately elevated glucagon secretion, slowing of gastric emptying, and reduction of food intake.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The optimized lipid-based formulation had a particle size of 106 nm.
Research context only—not evidence of a treatment effect.
- A two-tier protection strategy for oral delivery of GLP-1 peptides: lipid-based formulation combined with enteric capsules.
with a final particle size of 106 nm,
Safety + tolerability
Risks, organized for scanning.
Contraindications
- Serious hypersensitivity
- Product-specific renal and thrombocytopenia restrictions must be checked
Common effects
- Nausea
- Hypoglycemia with selected therapies
- Vomiting
Serious risks
- Acute pancreatitis
- Acute kidney injury
- Severe gastrointestinal disease
Structured from current product labeling [1]Regulatory labelByetta prescribing informationCurrent DailyMed label for immediate-release exenatide.
Products + regulatory context
Same ingredient. Different records.
| Product | Form | Profile scope | Record |
|---|---|---|---|
| Byetta | Twice-daily subcutaneous injection | Adjunct to diet and exercise in type 2 diabetes. | [1]Regulatory labelByetta prescribing informationCurrent DailyMed label for immediate-release exenatide. |
| Bydureon BCise | Weekly extended-release injection | Type 2 diabetes; formulation-specific administration and warnings. | DailyMed ↗ |
Do not infer dosing, interchangeability, or an approved use from the ingredient name alone. Open the current label for the exact product and presentation.
Administration, interactions + monitoring
The practical clinical context.
- Administration boundary
- Subcutaneous; timing and frequency are formulation-specific. [1]Regulatory labelByetta prescribing informationCurrent DailyMed label for immediate-release exenatide.
Research status + gaps
What still needs better answers.
Some extracted findings are not shown because they did not pass Peplexicon's automated evidence checks.
How Peplexicon reads evidence
- Authority
- What kind of source is making the statement?
- Independence
- Do multiple citations represent separate studies—or the same evidence repeated?
- Directness
- Does the population, product, dose, outcome, and time horizon match the claim?
- Consistency
- Do credible sources support, qualify, or contradict one another?
References + discovery
Open the records yourself.
- 1Regulatory labelByetta prescribing informationOpen ↗
Current DailyMed label for immediate-release exenatide.
- 2Literature indexEvery PubMed result for exenatideOpen ↗
Live National Library of Medicine literature search; results are not pre-screened or deduplicated.
- 3Trial registryEvery registered study for exenatideOpen ↗
Live ClinicalTrials.gov search, including completed, active, and historical records.