At a glance
What is it—and why does it matter?
Urodilatin, with INN name ularitide, is described as a human urine–derived natriuretic peptide within the A-type natriuretic peptide family. The abstract attributes ularitide’s vasodilatory, diuretic, and natriuretic actions to signaling through natriuretic peptide receptors that activate particulate guanylate cyclase and increase cyclic guanosine monophosphate. The trial used two coprimary endpoints: longer-term cardiovascular mortality (median follow-up 15 months) and a short-term hierarchical composite capturing the initial 48-hour clinical course. Urodilatin is described as a 32–amino acid peptide generated by differential processing of the same precursor that produces ANP.
Sources for this introduction: [1] [2] [3] [4]
This published profile is a reference in progress. Findings retain their source context; missing topics are marked below.
What is it?
A molecule, not a product name.
Identity
In ChEMBL, ularitide (CHEMBL2103920) is categorized as a protein therapeutic candidate with maximum development phase 3.0; no first approval year is provided.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“ChEMBL ID: CHEMBL2103920 Preferred name: ULARITIDE Molecule type: Protein Maximum development phase: 3.0 First approval year: not reported”
ULARITIDE · Molecule identity
chembl-molecule:chembl2103920:9bf9b5d84dc0:9bf9b5d84dc0
Identity
Urodilatin, with INN name ularitide, is described as a human urine–derived natriuretic peptide within the A-type natriuretic peptide family.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“Urodilatin (INN: Ularitide) is a natriuretic peptide isolated from human urine and belongs to the family of A-type natriuretic peptides.”
The renal urodilatin system: clinical implications. · Abstract
pubmed:11476735:ddafcb4d4ef5:ddafcb4d4ef5
Identity
Ularitide is the INN for urodilatin, indicating they refer to the same named peptide entity in this source.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“Urodilatin (INN: ularitide) represents another member of the natriuretic peptide family with a unique molecular structure that may provide distinct benefits in the treatment of ADHF.”
Ularitide: a natriuretic peptide candidate for the treatment of acutely decompensated heart failure. · Abstract
pubmed:26278236:8eeb39769f0d:8eeb39769f0d
Identity
Ularitide is a synthetic 32 amino acid peptidomimetic modeled on human urodilatin, which is described here as atrial natriuretic peptide (95-126).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“Ularitide is a synthetic 32 amino acid peptidomimetic of human urodilatin (atrial natriuretic peptide (95-126)).”
IUPHAR ligand commentary · General comments
iuphar-comments:8446:e5eb7a62d572:e5eb7a62d572
Identity
Ularitide is a synthetic version of urodilatin, a human natriuretic peptide.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“One of the drugs currently in clinical testing in Phase III is ularitide, which is the chemically synthesized form of the human natriuretic peptide urodilatin.”
Ularitide for the treatment of acute decompensated heart failure: from preclinical to clinical studies. · Abstract
pubmed:25670819:9b9383b9b536:9b9383b9b536
Identity
Ularitide is described as a synthetic natriuretic peptide, and it is being evaluated as a vasoactive treatment in ADHF.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“No direct comparisons between ularitide-a synthetic natriuretic peptide being evaluated in ADHF-and other vasoactive substances are available.”
Randomized double-blind clinical studies of ularitide and other vasoactive substances in acute decompensated heart failure: a systematic review and meta-analysis. · AIMS
pubmed:30246939:dba83ec513b9:dba83ec513b9
Identity
The ChEMBL record provides a peptide/protein sequence component for ularitide: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“Component 1: TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY”
ULARITIDE · Sequence
chembl-molecule:chembl2103920:9bf9b5d84dc0:9bf9b5d84dc0
How does it work?
Target, response, and disposition.
Mechanism
The abstract attributes ularitide’s vasodilatory, diuretic, and natriuretic actions to signaling through natriuretic peptide receptors that activate particulate guanylate cyclase and increase cyclic guanosine monophosphate.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“Ularitide exerts its pharmacological actions such as vasodilation, diuresis, and natriuresis through the natriuretic peptide receptor/particulate guanylate cyclase/cyclic guanosine monophosphate pathway.”
Ularitide for the treatment of acute decompensated heart failure: from preclinical to clinical studies. · Abstract
pubmed:25670819:9b9383b9b536:9b9383b9b536
Mechanism
Human urodilatin production is described as differential processing of pro-atrial natriuretic peptide in distal renal tubule cells.
1 cited source · Study independence not established
Animal or laboratory findings do not establish benefit or safety in people.
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“Urodilatin is produced in humans by differential processing of pro-atrial natriuretic peptide in distal renal tubule cells.”
Ularitide for the treatment of acute decompensated heart failure: from preclinical to clinical studies. · Abstract
pubmed:25670819:9b9383b9b536:9b9383b9b536
Mechanism
Ularitide is described as mimicking atrial natriuretic peptide (ANP) by inhibiting the renin-angiotensin-aldosterone system (RAAS).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“Ularitide effectively mimics ANP's inhibitory action on the renin-angiotensin-aldosterone system”
IUPHAR ligand commentary · Mechanism of action
iuphar-comments:8446:e5eb7a62d572:e5eb7a62d572
Pharmacokinetics
Urodilatin is described as a 32–amino acid peptide generated by differential processing of the same precursor that produces ANP.
2 cited sources · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
2 cited passages across 2 source records. 2 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“Molecular formula: C145H234N52O44S3 Molecular weight: 3505.99”
ULARITIDE · Molecular properties
chembl-molecule:chembl2103920:9bf9b5d84dc0:9bf9b5d84dc0 - supports · Source-backed record
“Urodilatin is differentially processed to a peptide of 32 amino acids from the same precursor as ANP.”
The renal urodilatin system: clinical implications. · Abstract
pubmed:11476735:ddafcb4d4ef5:ddafcb4d4ef5
What has been studied?
What the evidence says.
Comparative evidence
In a meta-analysis of randomized double-blind studies in hospitalized ADHF patients, ularitide had a statistically significant effect on PAWP versus placebo at 6 h (standardized effect size reported as Hedges' g).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“At 6 h, significant PAWP benefits for ularitide over placebo were seen (Hedges' g effect size, -0.979; P < 0.0001).”
Randomized double-blind clinical studies of ularitide and other vasoactive substances in acute decompensated heart failure: a systematic review and meta-analysis. · METHODS AND RESULTS
pubmed:30246939:dba83ec513b9:dba83ec513b9
Comparative evidence
For right atrial pressure at 6 h, the meta-analysis reports different standardized effect sizes (Hedges’ g) for ularitide compared with other treatments, and the difference between these effect sizes was statistically significant.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“After 6 h, a significant difference in effect size between ularitide and all other treatments was observed for right atrial pressure (Hedges' g, -0.797 for ularitide and -0.304 for other treatments; P = 0.0274).”
Randomized double-blind clinical studies of ularitide and other vasoactive substances in acute decompensated heart failure: a systematic review and meta-analysis. · METHODS AND RESULTS
pubmed:30246939:dba83ec513b9:dba83ec513b9
Study findings
Relative to placebo, ularitide produced a larger decrease in systolic blood pressure during the studied period.
2 cited sources · 1 linked study ID
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
2 cited passages across 2 source records.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“The ularitide group had greater reductions in systolic blood pressure and in levels of N-terminal pro-brain natriuretic peptide than the placebo group.”
Effect of Ularitide on Cardiovascular Mortality in Acute Heart Failure. · RESULTS
pubmed:28402745:d0df2d44141a:d0df2d44141a - supports · Source-backed record
“The ularitide group had greater reductions in systolic blood pressure and in levels of N-terminal pro-brain natriuretic peptide than the placebo group.”
Effect of Ularitide on Cardiovascular Mortality in Acute Heart Failure. · Abstract
doi:10.1056/nejmoa1601895:ebcb58b4e1b5:ebcb58b4e1b5
Study findings
Compared with placebo, ularitide produced a larger decrease in N-terminal pro-brain natriuretic peptide levels.
1 cited source · 1 linked study ID
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“The ularitide group had greater reductions in systolic blood pressure and in levels of N-terminal pro-brain natriuretic peptide than the placebo group.”
Effect of Ularitide on Cardiovascular Mortality in Acute Heart Failure. · RESULTS
pubmed:28402745:d0df2d44141a:d0df2d44141a
Study findings
The stated goal was to quantify haemodynamic effect sizes using evidence from randomized, double-blind clinical trials conducted in acute decompensated heart failure (ADHF).
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“The aim of this meta-analysis was to determine haemodynamic effect sizes from randomized double-blind trials in ADHF.”
Randomized Double-Blind Clinical Studies of Ularitide and Other Vasoactive Substances in Acute Decompensated Heart Failure: A Systematic Review and Meta-Analysis · Abstract
doi:10.1002/ehf2.12349:7756a79eb5f6:7756a79eb5f6
Study findings
In the subset with paired biomarker measurements (55% of patients), the treatment did not produce a detectable between-group difference in cardiac troponin T change during infusion.
1 cited source · 1 linked study ID
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“However, changes in cardiac troponin T levels during the infusion did not differ between the two groups in the 55% of patients with paired data.”
Effect of Ularitide on Cardiovascular Mortality in Acute Heart Failure. · Abstract
doi:10.1056/nejmoa1601895:ebcb58b4e1b5:ebcb58b4e1b5
Study findings
Relative to placebo, ularitide was associated with a larger reduction in N-terminal pro-brain natriuretic peptide (NT-proBNP), a biomarker of cardiac stress.
1 cited source · 1 linked study ID
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“The ularitide group had greater reductions in systolic blood pressure and in levels of N-terminal pro-brain natriuretic peptide than the placebo group.”
Effect of Ularitide on Cardiovascular Mortality in Acute Heart Failure. · Abstract
doi:10.1056/nejmoa1601895:ebcb58b4e1b5:ebcb58b4e1b5
Study findings
Using an intention-to-treat approach, the hierarchical composite endpoint summarizing the initial 48-hour clinical course showed no statistically significant difference between ularitide and placebo.
1 cited source · 1 linked study ID
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“In the intention-to-treat analysis, there was no significant between-group difference with respect to the hierarchical composite outcome.”
Effect of Ularitide on Cardiovascular Mortality in Acute Heart Failure. · Abstract
doi:10.1056/nejmoa1601895:ebcb58b4e1b5:ebcb58b4e1b5
Study findings
The meta-analysis included twelve randomized, double-blind studies and reports available data at 3, 6, and 24 h with sample sizes n = 622, 644, and 644 at those timepoints, respectively.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“Twelve randomized, double-blind studies were identified with data after 3, 6, and 24 h of treatment (n = 622, 644, and 644, respectively).”
Randomized Double-Blind Clinical Studies of Ularitide and Other Vasoactive Substances in Acute Decompensated Heart Failure: A Systematic Review and Meta-Analysis · Abstract
doi:10.1002/ehf2.12349:7756a79eb5f6:7756a79eb5f6
Study findings
The trial used two coprimary endpoints: longer-term cardiovascular mortality (median follow-up 15 months) and a short-term hierarchical composite capturing the initial 48-hour clinical course.
1 cited source · 1 linked study ID
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“The coprimary outcomes were death from cardiovascular causes during a median follow-up of 15 months and a hierarchical composite end point that evaluated the initial 48-hour clinical course.”
Effect of Ularitide on Cardiovascular Mortality in Acute Heart Failure. · Abstract
doi:10.1056/nejmoa1601895:ebcb58b4e1b5:ebcb58b4e1b5
Study findings
Using an intention-to-treat framework, the trial’s hierarchical composite endpoint showed no statistically significant separation between ularitide and placebo.
1 cited source · 1 linked study ID
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record.
Evidence boundary: Applies only to the source-defined population, formulation, dose, and assessment period.
Exact passages, locators, and provenance
- supports · Source-backed record
“In the intention-to-treat analysis, there was no significant between-group difference with respect to the hierarchical composite outcome.”
Effect of Ularitide on Cardiovascular Mortality in Acute Heart Failure. · RESULTS
pubmed:28402745:d0df2d44141a:d0df2d44141a
Risks and interactions
Risks, organized for scanning.
This profile does not yet contain a published summary for this topic. This is a coverage gap, not evidence that no research exists.
Products and regulatory status
Same ingredient. Different records.
This profile does not yet contain a published summary for this topic. This is a coverage gap, not evidence that no research exists.
Administration context
The practical clinical context.
This profile does not yet contain a published summary for this topic. This is a coverage gap, not evidence that no research exists.
Additional research & classification gaps
9 archived statements are kept separate from drug-effect findings. Media studies, economic models, methods, and records with unresolved scope are not used as medical-effect evidence.
Inspect contextual research (9)
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Urodilatin is stated to strongly increase diuresis (urine output) and natriuresis (sodium excretion).
Research context only—not evidence of a treatment effect.
- IUPHAR ligand commentary
Urodilatin induces strong diuresis and natriuresis,
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The text characterizes urodilatin as a regulatory peptide with diuretic-natriuretic properties.
Research context only—not evidence of a treatment effect.
- The renal urodilatin system: clinical implications.
considering Urodilatin as a real diuretic-natriuretic regulatory peptide.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The record lists multiple alternate names for ularitide, including Urodilatin and Ularitide acetate.
Research context only—not evidence of a treatment effect.
- ULARITIDE
Ularitida; Ularitide; Ularitide acetate; Urodilatin; Urodilatin ularitide
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Urodilatin is identified as a kidney-specific fragment derived from ANP.
Research context only—not evidence of a treatment effect.
- IUPHAR ligand commentary
Urodilatin is a kidney specific fragment of ANP.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Ularitide is described as a synthetic analogue of urodilatin.
Research context only—not evidence of a treatment effect.
- Haemodynamic and clinical effects of ularitide in decompensated heart failure.
Ularitide is a synthetic form of urodilatin,
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
Physiologically, the renal urodilatin system is characterized as an intrarenal paracrine mechanism contributing to Na(+) and water homeostasis.
Research context only—not evidence of a treatment effect.
- The renal urodilatin system: clinical implications.
Thus, the physiological function of the renal Urodilatin system can be described as a paracrine intrarenal regulator for Na(+) and water homeostasis,
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The source states that RAAS activation occurs early in congestive heart failure and is associated with stimulation of water excretion through the kidneys.
Research context only—not evidence of a treatment effect.
- IUPHAR ligand commentary
which is activated early in the development of congestive heart failure (CHF) to stimulate water excretion via the kidneys
6 cited sources · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
6 cited passages across 6 source records. 5 publication group(s) lack a resolved study identity.
Urodilatin is described as a renal natriuretic peptide associated with vasodilation, natriuresis, and diuresis.
Research context only—not evidence of a treatment effect.
- IUPHAR ligand commentary
being invloved in the regulation of body fluid volume and water-electrolyte excretion.
- Prevention Of Nephrotoxicity Following Allogeneic Bone Marrow Transplantation Using Urodilatin (Ularitide,Atrial Natriuretic Peptide) and Mannitol.
The purpose of the study is to combine Urodilatin (ANP analogue),
- Randomized Double-Blind Clinical Studies of Ularitide and Other Vasoactive Substances in Acute Decompensated Heart Failure: A Systematic Review and Meta-Analysis
No direct comparisons between ularitide—a synthetic natriuretic peptide being evaluated in ADHF—and other vasoactive substances are available.
- The renal urodilatin system: clinical implications.
It is synthesized in kidney tubular cells and secreted luminally.
- Haemodynamic and clinical effects of ularitide in decompensated heart failure.
a natriuretic peptide produced in the kidney with vasodilating, natriuretic, and diuretic effects,
- Ularitide: a natriuretic peptide candidate for the treatment of acutely decompensated heart failure.
Natriuretic peptides properties include diuresis, natriuresis, vasorelaxation, inhibition of renin-angiotensin-aldosterone system, and are thus chosen in the treatment of ADHF.
1 cited source · Study independence not established
How to read this evidence
Sources and study IDs describe provenance, not clinical strength. Several articles can report the same study; one study can support several distinct findings. No clinical strength rating has been assigned here.
1 cited passage across 1 source record. 1 publication group(s) lack a resolved study identity.
The factors or mechanisms controlling urodilatin secretion are stated to remain unclear.
Research context only—not evidence of a treatment effect.
- The renal urodilatin system: clinical implications.
However, the regulation upon which the Urodilatin secretion depends is still not clear.
Research status + gaps
What still needs better answers?
- No publishable claim yet for: administration, contraindication, interaction, regulatory, safety
- 84 compiled claim(s) withheld by automated assurance: assurance_score_below_0.58 (49), assurance_score_below_0.72 (31), current_regulatory_source_required (24), extraction_ambiguity (45), high_risk_requires_regulatory_or_two_independent_sources (33), no_direct_support (75)
These are the limits of this profile, not an exhaustive list of scientific uncertainties.
References + discovery
Open the records yourself.
- ULARITIDE ↗
chembl-molecule · published 2026-08-30 · retrieved 2026-08-30T08:40:08Z
- Prevention Of Nephrotoxicity Following Allogeneic Bone Marrow Transplantation Using Urodilatin (Ularitide,Atrial Natriuretic Peptide) and Mannitol. ↗
clinicaltrials · published 2008-06-03 · retrieved 2026-08-30T08:40:08Z
- Randomized Double-Blind Clinical Studies of Ularitide and Other Vasoactive Substances in Acute Decompensated Heart Failure: A Systematic Review and Meta-Analysis ↗
doi · published 2018-09-24 · retrieved 2026-09-04T22:25:24Z
- Effect of Ularitide on Cardiovascular Mortality in Acute Heart Failure. ↗
doi · published 2017-04-12 · retrieved 2026-09-04T22:25:25Z
- IUPHAR ligand commentary ↗
iuphar-comments · published 2026-08-30 · retrieved 2026-08-30T08:40:08Z
- The renal urodilatin system: clinical implications. ↗
pubmed · published 2001-08-15 · retrieved 2026-09-09T10:53:06Z
- Haemodynamic and clinical effects of ularitide in decompensated heart failure. ↗
pubmed · published 2006-12-01 · retrieved 2026-09-09T10:53:07Z
- Ularitide for the treatment of acute decompensated heart failure: from preclinical to clinical studies. ↗
pubmed · published 2015-03-21 · retrieved 2026-09-04T22:25:24Z
- Ularitide: a natriuretic peptide candidate for the treatment of acutely decompensated heart failure. ↗
pubmed · published 2015-09-01 · retrieved 2026-09-09T18:03:59Z
- Effect of Ularitide on Cardiovascular Mortality in Acute Heart Failure. ↗
pubmed · published 2017-05-18 · retrieved 2026-09-04T22:25:25Z
- Randomized double-blind clinical studies of ularitide and other vasoactive substances in acute decompensated heart failure: a systematic review and meta-analysis. ↗
pubmed · published 2018-12-01 · retrieved 2026-09-09T23:12:53Z
Publication history and provenance
Version 2 · Automated assessment · 2026-09-09T23:12:53Z
346b3cd0562b7ee785f707d770fdb46db025bc333ced296d4015dd6f7ccc38ea